PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3547s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 697aa    MW: 79369.7 Da    PI: 7.045
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3547s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.4e-182682157
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            ++kR   +++qle+Le+ +  + yps+  r+eL+ +lgL++rq ++WF+ rR k++k
  SapurV1A.3547s0010.1.p 26 KSKRKMKSASQLEILEKIYSVDTYPSEVVRAELSVQLGLSDRQLQMWFCHRRLKDRK 82
                            6799***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-171382IPR009057Homeodomain-like
SuperFamilySSF466891.07E-152082IPR009057Homeodomain-like
PROSITE profilePS5007116.2442383IPR001356Homeobox domain
SMARTSM003898.9E-152587IPR001356Homeobox domain
CDDcd000866.75E-132682No hitNo description
PfamPF000461.7E-152682IPR001356Homeobox domain
SMARTSM005711.0E-21556615IPR018501DDT domain
PROSITE profilePS5082717.101556615IPR018501DDT domain
PfamPF027916.6E-18557612IPR018501DDT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MEEAAADGGG VEVEAKNKTP GEGESKSKRK MKSASQLEIL EKIYSVDTYP SEVVRAELSV  60
QLGLSDRQLQ MWFCHRRLKD RKAPSVKRPC KESPSLAGMP SGGETGVVAE VGNEHGSGSS  120
PFVLGVDPRR AVGRPTGVAV PRISADVQTM NRYYEPQQSI AELRAIAFVE AQLGEPLRED  180
GPILGMEFDP LPPDAFGAPI GSATTGQQKQ PVRVFEANLY ERPDVKPIKS TTRTLHEYQF  240
LPQQPTVRAE AYERAAPSCQ YGSPADGHNV KTGSISATLP FMHANEQVSS EYGLSNQVPS  300
LSLMPQESRQ GHRFPSTTEY ETVLQKCSFT NIGMDVQSGA HLVTALDNPC MSSDRRITHD  360
EDALRMERKR KSEEARIARE VEAHEKRIRK ELEKQDILRR RREEQMRKEM EKHDRERRKE  420
EERLLREKQR EVERYQREQR RELERREKYL QKESIRVEKM RQKEELRREK EAARQKAATE  480
RARARRMAKE SLELIDDERL ELMEVAASSK GLPSIIPLDF ETLQNLDLFR DKLTEFPPKS  540
VLLKRPFLIQ PWNDSEENVG NLLMVWRFLI TFADILGIWP FTLDEFVQAF HDYDPRLLSE  600
IHVSLLKSII KDIEDVARTP STGLGQNQNG AANPGGGHPQ IVEGAYAWGF DLRSWQRHLN  660
PLTWPEILRQ FGLSAGFGPQ LKKRNVDQAY LRDDNE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047700.10.0PREDICTED: uncharacterized protein LOC105141971 isoform X3
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLB9HGS00.0B9HGS0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.21e-88Homeodomain-like transcriptional regulator